Transcript | Ll_transcript_533351 |
---|---|
CDS coordinates | 1832-2242 (+) |
Peptide sequence | MTAEPSIIIRKLEPEDLFLIFASDGLWEQLSDEAAVNIVFKYPRAGIAKRLVRTALQKAAKKREMRYDDIKKIDKGIRRHFHDDITVIVIFLDHQGGSSHGRFKQTAVGCTTAPADIFSLNAEEAEAEKSMLSSVG* |
ORF Type | complete |
Blastp | Probable protein phosphatase 2C 63 from Arabidopsis with 68.99% of identity |
---|---|
Blastx | Probable protein phosphatase 2C 63 from Arabidopsis with 71.63% of identity |
Eggnog | Phosphatase(COG0631) |
Kegg | Link to kegg annotations (AT4G33920) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428796.1) |
Pfam | Protein phosphatase 2C (PF00481.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer