Protein coding transcript 82389

• Transcript: Ll_transcript_533696
• CDS coordinates: 220-621 (+)
• Peptide sequence: MHVGTTIIRGKMEFGMAKGELYLRVSGIIVLVLTACLVAFDNQTKVILLTIEKKATYKDMNALKILVYVTSAAAGYNMLQLCKYYVSAYSRGNFKGSYIYMPWISLLLDQVNFFILIMCCQYLKKNHRNSYIL*
• ORF Type: complete

Annotations of Ll_transcript_533696

• Blastp: CASP-like protein 2C1 from Soja with 67.31% of identity
• Blastx: CASP-like protein 2C1 from Soja with 67.31% of identity
• Eggnog: CASP-like protein(ENOG410YWVN)
• Kegg: Link to kegg annotations (100306345)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454220.1)
• Pfam: Domain of unknown function (DUF588) (PF04535.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;