| Transcript | Ll_transcript_533702 |
|---|---|
| CDS coordinates | 541-891 (+) |
| Peptide sequence | MLQLCKYYVSAYSRGNFKGSYIYMPWISLLLDQMAVYITLAANCAAVEASVLAITGSESFEWIKVCNRFTRFCFQIGGALLCGYVASILMALISIISTYKVFRMYSPKWFLRLKTR* |
| ORF Type | complete |
| Blastp | CASP-like protein 2C1 from Soja with 69.57% of identity |
|---|---|
| Blastx | CASP-like protein 2C1 from Soja with 61.61% of identity |
| Eggnog | CASP-like protein(ENOG410YWVN) |
| Kegg | Link to kegg annotations (100306345) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019454220.1) |
| Pfam | Domain of unknown function (DUF588) (PF04535.11) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer