Protein coding transcript 82466

• Transcript: Ll_transcript_531144
• CDS coordinates: 641-1153 (+)
• Peptide sequence: MEEIHSASQDAVNGVPSRRPIMEMTIPSVLDKTISPPGKHVINLFVQYTPYKPLDGDWQDHDYRESFAQKCFTLIDEYAPGFSTSVIGYDMLTPPDLEREIGLKGGNIFHGAMGLDSLFLMRPVKRWSNYKTPLRGLYLCGSGAHPGGGVMGAPGRNAAQLVLQDNRKTT*
• ORF Type: complete

Annotations of Ll_transcript_531144

• Blastp: Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2 from Bos with 59.15% of identity
• Blastx: Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2 from Bos with 54.5% of identity
• Eggnog: phytoene(COG1233)
• Kegg: Link to kegg annotations (519120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446764.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;