Protein coding transcript 82469

• Transcript: Ll_transcript_531147
• CDS coordinates: 3-530 (+)
• Peptide sequence: GKIMTTELVCSVFFLCINYYVLLCNLGSKFVLFHHGYVLLCMCTSKAITASSIFMLKGSSLYFVYPLIQESFAQKCFTLIDEYAPGFSTSVIGYDMLTPPDLEREIGLKGGNIFHGAMGLDSLFLMRPVKRWSNYKTPLRGLYLCGSGAHPGGGVMGAPGRNAAQLVLQDNRKTT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_531147

• Blastp: Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2 from Rattus with 63.73% of identity
• Blastx: Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2 from Rattus with 63.73% of identity
• Eggnog: phytoene(COG1233)
• Kegg: Link to kegg annotations (309381)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446764.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;