| Transcript | Ll_transcript_531161 |
|---|---|
| CDS coordinates | 1104-1466 (+) |
| Peptide sequence | MTIFYGGQAHVFDYVHPHKADVIMSLAGSNSGSWSTAFSQKSAGKLISDSNLHSGENEIGMVSNVPLPHELHGRLSITGSSSHAVGHSDRVSTPAGAYQGSIVAKDTRKHVQTTDPSSEA* |
| ORF Type | complete |
| Blastp | Protein TIFY 8 from Arabidopsis with 35.74% of identity |
|---|---|
| Blastx | Protein TIFY 8 from Arabidopsis with 39.52% of identity |
| Eggnog | TIFY domain protein 8(ENOG41123AX) |
| Kegg | Link to kegg annotations (AT4G32570) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019416510.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer