| Transcript | Ll_transcript_531396 |
|---|---|
| CDS coordinates | 276-623 (+) |
| Peptide sequence | MADHHEHEEVKGESLLEKISGKIHDHDSSSSIKSKVFRIFGREKPVHHVLGGGKPADVLLWRNKKISATVLGVVTAIWVLFELLEYGFLTLVCHLLIIALAVLFLWSNASAFINK* |
| ORF Type | complete |
| Blastp | Reticulon-like protein B5 from Arabidopsis with 59.38% of identity |
|---|---|
| Blastx | Reticulon-like protein B1 from Arabidopsis with 53.97% of identity |
| Eggnog | Reticulon(ENOG410XPKH) |
| Kegg | Link to kegg annotations (AT2G46170) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019422265.1) |
| Pfam | Reticulon (PF02453.16) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer