Protein coding transcript 82495

• Transcript: Ll_transcript_531401
• CDS coordinates: 282-683 (+)
• Peptide sequence: MADHHEHEEVKGESLLDKISGIIHDHDSSSSDSDNEKKNEKKASSPPSSIKSKVFRLFGREKPVHHVLGGGKPADVFLWRNKKISGTVLGVATAVWVLFELLEYHFLTLVSHLLIFTLAALFLWSNASAFISK*
• ORF Type: complete

Annotations of Ll_transcript_531401

• Blastp: Reticulon-like protein B5 from Arabidopsis with 59.4% of identity
• Blastx: Reticulon-like protein B1 from Arabidopsis with 55.56% of identity
• Eggnog: Reticulon(ENOG410XPKH)
• Kegg: Link to kegg annotations (AT2G46170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446557.1)
• Pfam: Reticulon (PF02453.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;