Transcript | Ll_transcript_531401 |
---|---|
CDS coordinates | 282-683 (+) |
Peptide sequence | MADHHEHEEVKGESLLDKISGIIHDHDSSSSDSDNEKKNEKKASSPPSSIKSKVFRLFGREKPVHHVLGGGKPADVFLWRNKKISGTVLGVATAVWVLFELLEYHFLTLVSHLLIFTLAALFLWSNASAFISK* |
ORF Type | complete |
Blastp | Reticulon-like protein B5 from Arabidopsis with 59.4% of identity |
---|---|
Blastx | Reticulon-like protein B1 from Arabidopsis with 55.56% of identity |
Eggnog | Reticulon(ENOG410XPKH) |
Kegg | Link to kegg annotations (AT2G46170) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446557.1) |
Pfam | Reticulon (PF02453.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer