Protein coding transcript 82496

• Transcript: Ll_transcript_531402
• CDS coordinates: 276-770 (+)
• Peptide sequence: MADHHEHEEVKGESLLEKISGKIHDHDSSSSIKSKVFRIFGREKPVHHVLGGGKPADVLLWRNKKISATVLGVVTAIWVLFELLEYGFLTLVCHLLIIALAVLFLWSNASAFINKSTPKIPQVHIPEEPVLQFASALRLEINRAFAVLRDIASGRDLKKFLSVC*
• ORF Type: complete

Annotations of Ll_transcript_531402

• Blastp: Reticulon-like protein B3 from Arabidopsis with 60.8% of identity
• Blastx: Reticulon-like protein B1 from Arabidopsis with 72.22% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT1G64090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422265.1)
• Pfam: Reticulon (PF02453.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;