Protein coding transcript 82532

• Transcript: Ll_transcript_532106
• CDS coordinates: 248-1156 (+)
• Peptide sequence: MEYENRFRQAQRPKYDCLLFDLDDTLYPLSTGFHKVCTQNIRDYMVEKLGIDKSKIDELSNLLYRNYGTTMAGLRGIGYDFDYDDYHSFIHGRLPYENLKPDPVLRNLLLSLPYRKLIFTNADKIHAVKALRRLGLEDCFEGIICFETLNPINKNIVSYDEDNIEFIGSSKTNHIVTRNGASRSQIFDIIGHFAQPNPCVDLPKTPIICKPSQNAIEFALKIAHLNPQRTLFFEDSVRNIQAGKRVGLHTVLVGTSQKVKGADYALENIHNLKQAVPELWEGDIKSEIDYPTKLAMETFVTA*
• ORF Type: complete

Annotations of Ll_transcript_532106

• Blastp: Uncharacterized protein C24B11.05 from Schizosaccharomyces with 40.31% of identity
• Blastx: Uncharacterized protein C24B11.05 from Schizosaccharomyces with 40.31% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC24B11.05)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459249.1)
• Pfam: Haloacid dehalogenase-like hydrolase (PF13419.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;