Transcript | Ll_transcript_532106 |
---|---|
CDS coordinates | 248-1156 (+) |
Peptide sequence | MEYENRFRQAQRPKYDCLLFDLDDTLYPLSTGFHKVCTQNIRDYMVEKLGIDKSKIDELSNLLYRNYGTTMAGLRGIGYDFDYDDYHSFIHGRLPYENLKPDPVLRNLLLSLPYRKLIFTNADKIHAVKALRRLGLEDCFEGIICFETLNPINKNIVSYDEDNIEFIGSSKTNHIVTRNGASRSQIFDIIGHFAQPNPCVDLPKTPIICKPSQNAIEFALKIAHLNPQRTLFFEDSVRNIQAGKRVGLHTVLVGTSQKVKGADYALENIHNLKQAVPELWEGDIKSEIDYPTKLAMETFVTA* |
ORF Type | complete |
Blastp | Uncharacterized protein C24B11.05 from Schizosaccharomyces with 40.31% of identity |
---|---|
Blastx | Uncharacterized protein C24B11.05 from Schizosaccharomyces with 40.31% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPAC24B11.05) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459249.1) |
Pfam | Haloacid dehalogenase-like hydrolase (PF13419.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer