Protein coding transcript 82536

• Transcript: Ll_transcript_532090
• CDS coordinates: 1-873 (+)
• Peptide sequence: IVLFTVLCFKLFFFILFWLSGFVPEMEYENRFRQVQRPKYDCLLFDLDDTLYPLSTGFHKVCTQNIRDYMVEKLGIEKNKIDELSNLLYKNYGTTMAGLRGIGYDFNYDDYHSFVHGKLPYENLKPDPVLRNLLLSLPYRKLIFTNADKAHAIKALSKLGLEDCFEGIICFETLNPINKNTVSDDEDYIEFIGSSKTNDPNTCNGDSRSKIFDIIGHFSQPNPCAVLPKTPIICKPSENAIEFALKIANLNPQRTMFFEDSVRNIQAGKCVGLHTVLVIKSLLILLCRMK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_532090

• Blastp: Uncharacterized protein C24B11.05 from Schizosaccharomyces with 39.53% of identity
• Blastx: Uncharacterized protein C24B11.05 from Schizosaccharomyces with 39.53% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC24B11.05)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414178.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;