Transcript | Ll_transcript_532414 |
---|---|
CDS coordinates | 236-697 (+) |
Peptide sequence | MEQSCVDTSLNLNVIPSQHIDLAAEVLVEELQRLSSENKRLTETLNKVCENYDALQKHLNQLKDADFEKEGTPLHKRKVESEINSMNMFGISSFTECSTITEEETFKRPRNNNNNNLPKVSKVLVRTEASDTSLVSSSLLLLLFFQLDISSHY* |
ORF Type | complete |
Blastp | Probable WRKY transcription factor 40 from Arabidopsis with 35.51% of identity |
---|---|
Blastx | Probable WRKY transcription factor 40 from Arabidopsis with 89.74% of identity |
Eggnog | WRKY transcription factor(ENOG410YHES) |
Kegg | Link to kegg annotations (AT1G80840) |
CantataDB | Link to cantataDB annotations (CNT0002450) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429369.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer