Protein coding transcript 82552

• Transcript: Ll_transcript_532426
• CDS coordinates: 236-766 (+)
• Peptide sequence: MEQSCVDTSLNLNVIPSQHIDLAAEVLVEELQRLSSENKRLTETLNKVCENYDALQKHLNQLKDADFEKEGTPLHKRKVESEINSMNMFGISSFTECSTITEEETFKRPRNNNNNNLPKVSKVLVRTEASDTSLYVRDGYQWRKYGQKVTRDNPSPRAYFKCSYAPSCQVKKKVII*
• ORF Type: complete

Annotations of Ll_transcript_532426

• Blastp: Probable WRKY transcription factor 40 from Arabidopsis with 46.89% of identity
• Blastx: Probable WRKY transcription factor 40 from Arabidopsis with 46.89% of identity
• Eggnog: WRKY transcription factor(ENOG410YHES)
• Kegg: Link to kegg annotations (AT1G80840)
• CantataDB: Link to cantataDB annotations (CNT0002450)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429369.1)
• Pfam: WRKY DNA -binding domain (PF03106.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;