Transcript | Ll_transcript_531812 |
---|---|
CDS coordinates | 136-504 (+) |
Peptide sequence | MPAYYRGTDMASPHGIPVDLLDRLVIIRTQTYGPGEMIQILAIRAQVEELVVDEECLAFLGEIGQRSSLRHAVQLLSPASIVAKMNGRDNICKADLDEVCSLYLDAKSSAKLLQEQQEKYIS* |
ORF Type | complete |
Blastp | RuvB-like protein 1 from Arabidopsis with 87.18% of identity |
---|---|
Blastx | RuvB-like protein 1 from Arabidopsis with 87.18% of identity |
Eggnog | ruvB-like(COG1224) |
Kegg | Link to kegg annotations (AT5G22330) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436439.1) |
Pfam | TIP49 C-terminus (PF06068.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer