Protein coding transcript 82582

• Transcript: Ll_transcript_533148
• CDS coordinates: 208-828 (+)
• Peptide sequence: MLGGLRVFLSHGNVIKNAVLQQVRMVNPLLQPVAFSRFESVKSARIEEHGFESTTIADILKGKGKGADGSWLWCTTDDTVYDAVKSMTQNNVGALVVVKPGGEQKSIAGIITERDYLRKIIVQGRSSKSTKVGDIMTEENKLITVSPDTKVLRAMQLMTDNRIRHIPVINDKGMIGMVSIGDVVRAVVSEHRQELDRLNAYIQGGY*
• ORF Type: complete

Annotations of Ll_transcript_533148

• Blastp: CBS domain-containing protein CBSX3, mitochondrial from Arabidopsis with 80.68% of identity
• Blastx: CBS domain-containing protein CBSX3, mitochondrial from Arabidopsis with 80.68% of identity
• Eggnog: Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate- limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth (By similarity)(COG0517)
• Kegg: Link to kegg annotations (AT5G10860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461826.1)
• Pfam: CBS domain (PF00571.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;