Transcript | Ll_transcript_533150 |
---|---|
CDS coordinates | 1098-1448 (+) |
Peptide sequence | MLGGLRVFLSHGNVIKNAVLQQVRMVNPLLQPVAFSRFESVKSARIEEHGFESTTIADILKGKGKGADGSWLWCTTDDTVYDAVKSMTQNNVGALVVVKPGGEQKSIAGIITERGN* |
ORF Type | complete |
Blastp | CBS domain-containing protein CBSX3, mitochondrial from Arabidopsis with 70.43% of identity |
---|---|
Blastx | CBS domain-containing protein CBSX3, mitochondrial from Arabidopsis with 93.48% of identity |
Eggnog | Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate- limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth (By similarity)(COG0517) |
Kegg | Link to kegg annotations (AT5G10860) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461826.1) |
Pfam | CBS domain (PF00571.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer