Protein coding transcript 82651

• Transcript: Ll_transcript_532708
• CDS coordinates: 192-800 (+)
• Peptide sequence: MPVQFIFSQKNILPFSLSLCCLCESTSEEDDFDSDEDLPLPTEENGISVQKAEEAKVSEPKKAHAKNSAPIKHVKIADPKKDDSDEDGDFGSSDDEMDDADSDDDEQTPVKKVELGKKRANDSASKTPVSNKKAKNSTPQKTDGKKGGHTDTPHPAKKAGKTPNSDAKGQTPKSAGQFSCESCKKAFKSEDGMQQHKKAKHG*
• ORF Type: complete

Annotations of Ll_transcript_532708

• Blastp: Histone deacetylase HDT1 from Soja with 54.4% of identity
• Blastx: Histone deacetylase HDT1 from Soja with 52.49% of identity
• Eggnog: Histone deacetylase(ENOG41120HP)
• Kegg: Link to kegg annotations (547649)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436321.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;