Transcript | Ll_transcript_532718 |
---|---|
CDS coordinates | 2-622 (+) |
Peptide sequence | LSHSSKSSSVFFCGYKALIPDEEDSEEDDFDSDEDLPLPTEENGISVQKAEEAKVSEPKKAHAKNSAPIKHVKIADPKKDDSDEDGDFGSSDDEVYKLTEMDDADSDDDEQTPVKKVELGKKRANDSASKTPVSNKKAKNSTPQKTDGKKGGHTDTPHPAKKAGKTPNSDAKGQTPKSAGQFSCESCKKAFKSEDGMQQHKKAKHG* |
ORF Type | 5prime_partial |
Blastp | Histone deacetylase HDT1 from Soja with 55.3% of identity |
---|---|
Blastx | Histone deacetylase HDT1 from Soja with 52.88% of identity |
Eggnog | Histone deacetylase(ENOG41120HP) |
Kegg | Link to kegg annotations (547649) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436321.1) |
Pfam | C2H2-type zinc finger (PF13912.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer