Protein coding transcript 82662

• Transcript: Ll_transcript_532726
• CDS coordinates: 909-1490 (+)
• Peptide sequence: MLSFCSTILGTVLRIPSEVLKQRLQAGLYENVGEALVGTWRHDGLKGFFRGTGATLCREVPFYVAGMGLYDESKKAVSKLLRRELEPWEMVVVGAITGGLASVTTTPFDVVKTRMMTSQGQSVSMSMVAFSILRQEGPLGLFKGAVPRFFWIAPLGAMNFAGYELARKALNKYAELAENKSSQKKAEKVASSE*
• ORF Type: complete

Annotations of Ll_transcript_532726

• Blastp: Putative mitochondrial carrier protein PET8 from Saccharomyces with 37.06% of identity
• Blastx: Putative mitochondrial carrier protein PET8 from Saccharomyces with 35% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YNL003C)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461504.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;