Transcript | Ll_transcript_532138 |
---|---|
CDS coordinates | 66-902 (+) |
Peptide sequence | MATALLKKAVNRIPSSPSWKLSLLRAHASEAQAQQVEPKARATSTPKTFQIYRWSPDSPSKPELKSYEINLKDCGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGCNGLACLTKIPAAAEATTVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPENEGKEILQSKKDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTKERLEAVNDEFKLYRCHTILNCARACPKGLNPGKQIQHIKSLQPKA* |
ORF Type | complete |
Blastp | Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial from Arabidopsis with 77.62% of identity |
---|---|
Blastx | Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial from Arabidopsis with 77.62% of identity |
Eggnog | succinate dehydrogenase(COG0479) |
Kegg | Link to kegg annotations (AT5G40650) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447431.1) |
Pfam | 2Fe-2S iron-sulfur cluster binding domain (PF13085.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer