Protein coding transcript 82735

• Transcript: Ll_transcript_531751
• CDS coordinates: 61-771 (+)
• Peptide sequence: MPHDGVFRFLFLVSLFTNSLSSIPKTDNIFLSIHHHNDDSLSSSASSCPAPNPNLNYRPVIGILTHPGDGASGRLSNATDASNIPASYIKFAESGGARVIPLIYNEPTEKLLKKLDLVNGVIFVGGWAKQGLYLETVERILKIAFQRNDAGEHFPIYGISLGFELITIIISEDNNILDKYNARNQASTLQFVENADIEGSIFQSFPPDLIKKLSTECIVTQNHHVSFIFSVFYGLY*
• ORF Type: complete

Annotations of Ll_transcript_531751

• Blastp: Gamma-glutamyl hydrolase 2 from Arabidopsis with 62.56% of identity
• Blastx: Gamma-glutamyl hydrolase 2 from Arabidopsis with 65.61% of identity
• Eggnog: Gamma-glutamyl hydrolase(ENOG410XQKI)
• Kegg: Link to kegg annotations (AT1G78680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443867.1)
• Pfam: Peptidase C26 (PF07722.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;