Protein coding transcript 82737

• Transcript: Ll_transcript_531735
• CDS coordinates: 61-771 (+)
• Peptide sequence: MPHDGVFRFLFLVSLFTNSLSSIPKTDNIFLSIHHHNDDSLSSSASSCPAPNPNLNYRPVIGILTHPGDGASGRLSNDTGASNIPASYVKFAESGGATVIPLIYNEPTEKLLKKLDLVNGVIFVGGWAKDGLYLETVERILKIAFQRNDVGDHFPIYGICLGFELITMIISEDNNILDKYNARNQASTLQFVENADIEGSIFQSFPPDLIKKLSTECIVTQNHHVSFIFSVFYGLY*
• ORF Type: complete

Annotations of Ll_transcript_531735

• Blastp: Gamma-glutamyl hydrolase 2 from Arabidopsis with 61.64% of identity
• Blastx: Gamma-glutamyl hydrolase 2 from Arabidopsis with 64.55% of identity
• Eggnog: Gamma-glutamyl hydrolase(ENOG410XQKI)
• Kegg: Link to kegg annotations (AT1G78680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443867.1)
• Pfam: Peptidase C26 (PF07722.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;