Protein coding transcript 82757

• Transcript: Ll_transcript_533466
• CDS coordinates: 157-705 (+)
• Peptide sequence: MVLFRKLLYRKPPDHLLQISDTIYVFDCCFSTVVLDEDEYRASIAGIVAQLQDDFPDVSFTVFDFKEGNKCSQISDMLSQYDMTVVEYPRQYEGCPLLPLKMIHHFLRTSESRLSMKGQQNVLLMHCERGGWSMLAFMLAGLLLYQKQYIVEQKTLEMVYKQAPRELLHLLSPLNQQPSQFRY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_533466

• Blastp: Formin-like protein 20 from Arabidopsis with 74.32% of identity
• Blastx: Formin-like protein 20 from Arabidopsis with 74.32% of identity
• Eggnog: FH2(ENOG41100UH)
• Kegg: Link to kegg annotations (AT5G07740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451518.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;