Transcript | Ll_transcript_532513 |
---|---|
CDS coordinates | 238-1251 (+) |
Peptide sequence | MCIKNGSHFGTVVHHIISQNITLHFHLSHSMALRFPLLALLFISAAVATAVYAERIDNNDLLIRQVVADTEDHLLNAEHHFSTFKAKFGKSYATKEEHDYRFGVFKKNLLRAKSHQKLDPSAVHGVTKFSDLTHSEFRRQFLGLNKPLRLPNDAHKAPILPTNDLPTDFDWRDHGAVTPVKNQGSCGSCWSFSTTGALEGAHFLATGELVGLSEQQLVDCDHECDPEERGACDSGCNGGLMNTAFEYALKVGGLVSEKDYPYTGRDRGACKFDKTKIAASVSNFSVVSIDEDQIAANLVKNGPLAGTSSSKIPERNFRNYLQDSFISFFKGQDILNY* |
ORF Type | complete |
Blastp | Cysteine proteinase 15A from Pisum with 77.22% of identity |
---|---|
Blastx | Cysteine proteinase 15A from Pisum with 77.22% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416201.1) |
Pfam | Cathepsin propeptide inhibitor domain (I29) (PF08246.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer