Protein coding transcript 82798

• Transcript: Ll_transcript_532513
• CDS coordinates: 238-1251 (+)
• Peptide sequence: MCIKNGSHFGTVVHHIISQNITLHFHLSHSMALRFPLLALLFISAAVATAVYAERIDNNDLLIRQVVADTEDHLLNAEHHFSTFKAKFGKSYATKEEHDYRFGVFKKNLLRAKSHQKLDPSAVHGVTKFSDLTHSEFRRQFLGLNKPLRLPNDAHKAPILPTNDLPTDFDWRDHGAVTPVKNQGSCGSCWSFSTTGALEGAHFLATGELVGLSEQQLVDCDHECDPEERGACDSGCNGGLMNTAFEYALKVGGLVSEKDYPYTGRDRGACKFDKTKIAASVSNFSVVSIDEDQIAANLVKNGPLAGTSSSKIPERNFRNYLQDSFISFFKGQDILNY*
• ORF Type: complete

Annotations of Ll_transcript_532513

• Blastp: Cysteine proteinase 15A from Pisum with 77.22% of identity
• Blastx: Cysteine proteinase 15A from Pisum with 77.22% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416201.1)
• Pfam: Cathepsin propeptide inhibitor domain (I29) (PF08246.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;