Transcript | Ll_transcript_532519 |
---|---|
CDS coordinates | 238-807 (+) |
Peptide sequence | MCIKNGSHFGTVVHHIISQNITLHFHLSHSMALRFPLLALLFISAAVATAVYAERIDNNDLLIRQVVADTEDHLLNAEHHFSTFKAKFGKSYATKEEHDYRFGVFKKNLLRAKSHQKLDPSAVHGVTKFSDLTHSEFRRQFLGLNKPLRLPNDAHKAPILPTNDLPTDFDWRDHGAVTPVKNQVCSYSQ* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | Probable cysteine protease RD19C from Arabidopsis with 73.74% of identity |
Eggnog | cathepsin(COG4870) |
Kegg | Link to kegg annotations (AT4G16190) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416201.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer