Protein coding transcript 82806

• Transcript: Ll_transcript_533829
• CDS coordinates: 1084-1389 (+)
• Peptide sequence: MHVCVQITYSIPFALASIFSITSGAGQGLSLGVLNLAIVIPQMIVSVLSGPWDAAFGGGNLPAFVVGAVAAAASGILSIVLLPSPPPELAKAATATGGGFH*
• ORF Type: complete

Annotations of Ll_transcript_533829

• Blastp: Sucrose transport protein from Spinacia with 79.35% of identity
• Blastx: Sucrose transport protein from Spinacia with 86.21% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002502)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441998.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;