Protein coding transcript 82819

• Transcript: Ll_transcript_533845
• CDS coordinates: 1-426 (+)
• Peptide sequence: WIAWFPFLLFDTDWMGKEVYGGSVGNGKASKAYDKGVRAGALGLMLNSVVLGVTSLGVEILARVVGSVKRLWGIVNFLLAISLAITVLVTKMAQHSRHFPDGDINADPLPPTAAIKAAAFTLFSLLGIPLAVTTLLHQNLCM
• ORF Type: internal

Annotations of Ll_transcript_533845

• Blastp: Sucrose transport protein SUC5 from Arabidopsis with 61.48% of identity
• Blastx: Sucrose transport protein SUC5 from Arabidopsis with 61.48% of identity
• Eggnog: solute carrier family 45 member(ENOG410XPTR)
• Kegg: Link to kegg annotations (AT1G71890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426858.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;