Protein coding transcript 82829

• Transcript: Ll_transcript_533823
• CDS coordinates: 1-402 (+)
• Peptide sequence: LYLITKMESLSSKKSNSLQVEALVPNESSPVRKIIVVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSFIWLCGPISGMLVQPFVGYHSDRCTSRFGRRRPFIAAGAIAVAVAVFPISGMLVQPFVGYHSDR
• ORF Type: internal

Annotations of Ll_transcript_533823

• Blastp: Sucrose transport protein SUC9 from Arabidopsis with 81.44% of identity
• Blastx: Sucrose transport protein SUC9 from Arabidopsis with 85.37% of identity
• Eggnog: solute carrier family 45 member(ENOG410XPTR)
• Kegg: Link to kegg annotations (AT5G06170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426858.1)
• Pfam: MFS/sugar transport protein (PF13347.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;