Protein coding transcript 82889

• Transcript: Ll_transcript_531361
• CDS coordinates: 97-699 (+)
• Peptide sequence: MASAIMKRASSSSTMRSISLSAALRIRNYAKVANGSDIVSAAPNVSLQKARSWDEGVSSKFSTTPIKDIFKDKKIVIFGLPGAYTGVCSSKHVPTYKDNIDKFKAKGIDSVVCVAINDPYTINAWAEKLQAKDAIEFYGDFDGSFHKSLELVTDLSGALLGTRSERWSAYVVDGKIKALNVEEAPSDVKVSGADTILGQI*
• ORF Type: complete

Annotations of Ll_transcript_531361

• Blastp: Peroxiredoxin-2F, mitochondrial from Arabidopsis with 72.28% of identity
• Blastx: Peroxiredoxin-2F, mitochondrial from Arabidopsis with 78.74% of identity
• Eggnog: peroxiredoxin(COG0678)
• Kegg: Link to kegg annotations (AT3G06050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418858.1)
• Pfam: AhpC/TSA family (PF00578.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;