| Transcript | Ll_transcript_279616 |
|---|---|
| CDS coordinates | 881-1192 (+) |
| Peptide sequence | MLNRNGSTMHNNAVFAETFRYTGEDGFEISVPSENAVDLAKAILEKSEGEIRLTGLGARDSLRLEAGLCLYGNDMEQHITPIEAGLTWAIGKRRRAESGFLGA* |
| ORF Type | complete |
| Blastp | Aminomethyltransferase, mitochondrial from Flaveria with 95.18% of identity |
|---|---|
| Blastx | Aminomethyltransferase, mitochondrial from Pisum with 80.48% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019419681.1) |
| Pfam | Aminomethyltransferase folate-binding domain (PF01571.20) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer