Protein coding transcript 83026

• Transcript: Ll_transcript_279619
• CDS coordinates: 467-907 (+)
• Peptide sequence: MCGLSLKGKDSVPFLEKLVAADVAGLAPGTGSLTVFTNEKGGAIDDSVITKVTDNHIYLVVNTGCRDKDLAHIEEHMKAFKAKGGDVSWHIHDERSLLALQGPLAAPVLQHLTKGDLSKLYFGQFCVLDINGSQCFLTRTGYVFFF*
• ORF Type: complete

Annotations of Ll_transcript_279619

• Blastp: Aminomethyltransferase, mitochondrial from Arabidopsis with 91.61% of identity
• Blastx: Aminomethyltransferase, mitochondrial from Pisum with 80.48% of identity
• Eggnog: The glycine cleavage system catalyzes the degradation of glycine (By similarity)(COG0404)
• Kegg: Link to kegg annotations (AT1G11860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419681.1)
• Pfam: Aminomethyltransferase folate-binding domain (PF01571.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;