Protein coding transcript 83027

• Transcript: Ll_transcript_279604
• CDS coordinates: 97-696 (+)
• Peptide sequence: MRGGLWQLGQSITRRLANGDKKAAARRYFATEAELKKTALYDFHVANGGKMVPFAGWSMPIQYKDSIMDSTLNCRENGSLFDVSHMCGLSLKGKDSVPFLEKLVIADVAALAPGTGSLTVFTNEKGGAIDDSVITKVTDHHIYLVVNAGCRDKDLAHIEEHMKSFKAKGGDVSWHIHDERSLLALQVTYHTLLHLHHTF*
• ORF Type: complete

Annotations of Ll_transcript_279604

• Blastp: Aminomethyltransferase, mitochondrial from Solanum with 89.78% of identity
• Blastx: Aminomethyltransferase, mitochondrial from Solanum with 89.78% of identity
• Eggnog: The glycine cleavage system catalyzes the degradation of glycine (By similarity)(COG0404)
• Kegg: Link to kegg annotations (102602939)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426057.1)
• Pfam: Aminomethyltransferase folate-binding domain (PF01571.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;