Protein coding transcript 83033

• Transcript: Ll_transcript_279611
• CDS coordinates: 310-918 (+)
• Peptide sequence: MRGGLWQLGQSITRRLANGDKKAAARRYFSAEAELKKTVLYDFHVAHGGKMVPFAGWSMPIQYKDSIMDSTLNCRENGSLFDVSHMCGLSLKGKDSVAFLEKLVIADVAGLAPGTGSLTVFTNEKGGAIDDSVITKVSDDHIYLVVNAGCRDKDLAHIEEHMKAFKAKGGDVSWHIHDERSLLALQVICHTLLHLHHTHFEL*
• ORF Type: complete

Annotations of Ll_transcript_279611

• Blastp: Aminomethyltransferase, mitochondrial from Flaveria with 88.32% of identity
• Blastx: Aminomethyltransferase, mitochondrial from Pisum with 94.57% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439837.1)
• Pfam: Aminomethyltransferase folate-binding domain (PF01571.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;