Transcript | Ll_transcript_279611 |
---|---|
CDS coordinates | 310-918 (+) |
Peptide sequence | MRGGLWQLGQSITRRLANGDKKAAARRYFSAEAELKKTVLYDFHVAHGGKMVPFAGWSMPIQYKDSIMDSTLNCRENGSLFDVSHMCGLSLKGKDSVAFLEKLVIADVAGLAPGTGSLTVFTNEKGGAIDDSVITKVSDDHIYLVVNAGCRDKDLAHIEEHMKAFKAKGGDVSWHIHDERSLLALQVICHTLLHLHHTHFEL* |
ORF Type | complete |
Blastp | Aminomethyltransferase, mitochondrial from Flaveria with 88.32% of identity |
---|---|
Blastx | Aminomethyltransferase, mitochondrial from Pisum with 94.57% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439837.1) |
Pfam | Aminomethyltransferase folate-binding domain (PF01571.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer