Protein coding transcript 83084

• Transcript: Ll_transcript_280292
• CDS coordinates: 71-757 (+)
• Peptide sequence: MATITTTITSSSSSLMFTHLQHSSLLLNSMHLNFRRGPSRPFQPLVAALEVAEAVEQDVEEESIMMKPKKGKAALALKRDRLRSKRFLEIQNLREHNKEYDLNTAIGLLKETAKTKFVETVEAHFRLNIDPKYNDQQLRATVSLPKGTGKPVKVAVLTQGERFDEAKNAGADLVGGEDLIEQIKGGFMEFDKLIASPDMMPKVFFSLSASNYCLGFLAFKVQLSFQYN*
• ORF Type: complete

Annotations of Ll_transcript_280292

• Blastp: 50S ribosomal protein L1, chloroplastic from Pisum with 88.89% of identity
• Blastx: 50S ribosomal protein L1, chloroplastic from Pisum with 94.02% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000332)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454375.1)
• Pfam: Ribosomal protein L1p/L10e family (PF00687.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;