Protein coding transcript 83086

• Transcript: Ll_transcript_280305
• CDS coordinates: 2-346 (+)
• Peptide sequence: SKPKKGKVALPLKRDMLRSKRFLQIQNTREHKKEYDLKTAISLVKETAKTKFVETVEAHFHLNIDPKYNDQQLRATASLPKVKDSMKPKMQELIWVEEKTSYNRSNKASWNLIN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_280305

• Blastp: 50S ribosomal protein L1, chloroplastic from Arabidopsis with 78.75% of identity
• Blastx: 50S ribosomal protein L1, chloroplastic from Pisum with 80.77% of identity
• Eggnog: Binds directly to 23S rRNA. The L1 stalk is quite mobile in the ribosome, and is involved in E site tRNA release (By similarity)(COG0081)
• Kegg: Link to kegg annotations (AT3G63490)
• CantataDB: Link to cantataDB annotations (CNT0002393)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004513669.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;