Transcript | Ll_transcript_280297 |
---|---|
CDS coordinates | 2-346 (+) |
Peptide sequence | SKPKKGKVALPLKRDMLRSKRFLQIQNTREHKKEYDLKTAISLVKETAKTKFVETVEAHFHLNIDPKYNDQQLRATASLPKVKDSMKPKMQELIWVEEKTSYNRSNKASWNLIN* |
ORF Type | 5prime_partial |
Blastp | 50S ribosomal protein L1, chloroplastic from Arabidopsis with 78.75% of identity |
---|---|
Blastx | 50S ribosomal protein L1, chloroplastic from Pisum with 80.77% of identity |
Eggnog | Binds directly to 23S rRNA. The L1 stalk is quite mobile in the ribosome, and is involved in E site tRNA release (By similarity)(COG0081) |
Kegg | Link to kegg annotations (AT3G63490) |
CantataDB | Link to cantataDB annotations (CNT0002393) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454375.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer