Transcript | Ll_transcript_280298 |
---|---|
CDS coordinates | 2-520 (+) |
Peptide sequence | SKPKKGKVALPLKRDMLRSKRFLQIQNTREHKKEYDLKTAISLVKETAKTKFVETVEAHFHLNIDPKYNDQQLRATVSLPKGTGKPVKVAVLTQGERFDEAKNAGADLVGGEDLIQQIKQGFMEFDKLIASPDMMPKVASLGKILGPRGLMPNPKAGTVTPNIPQAIAEFKQG |
ORF Type | internal |
Blastp | 50S ribosomal protein L1, chloroplastic from Pisum with 89.22% of identity |
---|---|
Blastx | 50S ribosomal protein L1, chloroplastic from Pisum with 89.22% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0002393) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454375.1) |
Pfam | Ribosomal protein L1p/L10e family (PF00687.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer