Protein coding transcript 83094

• Transcript: Ll_transcript_280298
• CDS coordinates: 2-520 (+)
• Peptide sequence: SKPKKGKVALPLKRDMLRSKRFLQIQNTREHKKEYDLKTAISLVKETAKTKFVETVEAHFHLNIDPKYNDQQLRATVSLPKGTGKPVKVAVLTQGERFDEAKNAGADLVGGEDLIQQIKQGFMEFDKLIASPDMMPKVASLGKILGPRGLMPNPKAGTVTPNIPQAIAEFKQG
• ORF Type: internal

Annotations of Ll_transcript_280298

• Blastp: 50S ribosomal protein L1, chloroplastic from Pisum with 89.22% of identity
• Blastx: 50S ribosomal protein L1, chloroplastic from Pisum with 89.22% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002393)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454375.1)
• Pfam: Ribosomal protein L1p/L10e family (PF00687.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;