Protein coding transcript 83095

• Transcript: Ll_transcript_280299
• CDS coordinates: 71-1021 (+)
• Peptide sequence: MATITTTITSSSSSLMFTHLQHSSLLLNSMHLNFRRGPSRPFQPLVAALEVAEAVEQDVEEESIMMKPKKGKAALALKRDRLRSKRFLEIQNLREHNKEYDLNTAIGLLKETAKTKFVETVEAHFRLNIDPKYNDQQLRATVSLPKGTGKPVKVAVLTQGERFDEAKNAGADLVGGEDLIEQIKGGFMEFDKLIASPDMMPKVASLGKILGPRGLMPNPKAGTVTPNIPQAIAEFKQGKVEFRADKTGIVHLPFGKADFPEEDLLVNLVAAIRSVEANKPSGAKGVYWKSAHVCSAMGPSIRLNIREMLDYKLPSE*
• ORF Type: complete

Annotations of Ll_transcript_280299

• Blastp: 50S ribosomal protein L1, chloroplastic from Arabidopsis with 74.65% of identity
• Blastx: 50S ribosomal protein L1, chloroplastic from Arabidopsis with 81.66% of identity
• Eggnog: Binds directly to 23S rRNA. The L1 stalk is quite mobile in the ribosome, and is involved in E site tRNA release (By similarity)(COG0081)
• Kegg: Link to kegg annotations (AT3G63490)
• CantataDB: Link to cantataDB annotations (CNT0000332)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454375.1)
• Pfam: Ribosomal protein L1p/L10e family (PF00687.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;