Transcript | Ll_transcript_280301 |
---|---|
CDS coordinates | 71-1021 (+) |
Peptide sequence | MATITTTITSSSSSLMFTHLQHSSLLLNSMHLNFRRGPSRPFQPLVAALEVAEAVEQDVEEESIMMKPKKGKAALALKRDRLRSKRFLEIQNLREHNKEYDLNTAIGLLKETAKTKFVETVEAHFRLNIDPKYNDQQLRATVSLPKGTGKPVKVAVLTQGERFDEAKNAGADLVGGEDLIEQIKGGFMEFDKLIASPDMMPKVASLGKILGPRGLMPNPKAGTVTPNIPQAIAEFKQGKVEFRADKTGIVHLPFGKADFPEEDLLVNLVAAIRSVEANKPSGAKGVYWKSAHICSAMGPSIKLNIREMLDYKFPSE* |
ORF Type | complete |
Blastp | 50S ribosomal protein L1, chloroplastic from Arabidopsis with 75.35% of identity |
---|---|
Blastx | 50S ribosomal protein L1, chloroplastic from Arabidopsis with 82.53% of identity |
Eggnog | Binds directly to 23S rRNA. The L1 stalk is quite mobile in the ribosome, and is involved in E site tRNA release (By similarity)(COG0081) |
Kegg | Link to kegg annotations (AT3G63490) |
CantataDB | Link to cantataDB annotations (CNT0000332) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454375.1) |
Pfam | Ribosomal protein L1p/L10e family (PF00687.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer