Protein coding transcript 8311

• Transcript: Ll_transcript_352177
• CDS coordinates: 143-847 (+)
• Peptide sequence: MESNQDQQTPKSHRFDLIILGASGFTGKYVVKEALKFLNNPSSPLKSIALAGRNATKLAQTLQWAAQPNPPPSLPILTADTTDPSSLRALCNQTSLILNCVGPFRLHAEPVVAACADTGCDYLDICGEPEFMERMEANYHDRAVETGSLVISACGFDSVPAELGFMFNSRQWVSPAVPNRVEAFVSLESERRIVGNFATYESAVLGVANAHKLQELRRSRPRRAKPVVRDKMWC*
• ORF Type: complete

Annotations of Ll_transcript_352177

• Blastp: Probable mitochondrial saccharopine dehydrogenase-like oxidoreductase At5g39410 from Arabidopsis with 69.41% of identity
• Blastx: Probable mitochondrial saccharopine dehydrogenase-like oxidoreductase At5g39410 from Arabidopsis with 76.47% of identity
• Eggnog: saccharopine dehydrogenase(COG3268)
• Kegg: Link to kegg annotations (AT5G39410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456838.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;