Protein coding transcript 83184

• Transcript: Ll_transcript_279814
• CDS coordinates: 264-788 (+)
• Peptide sequence: MKGLVPYTPLISRGKPPMLARVGILPCCPYFSRATLLSKLRCRAKSRLNFAHGTFRAQASDVCFGPADDRSNNAKDNQNVFEGSSINDGSSKIAKPLNRIPYPISIALVFSLIAFLKGGPSSVLAAISKSGFTAAFTLIFVSEIGDKVTTIITKTLCCSFLLHSQLPHFILSFL*
• ORF Type: complete

Annotations of Ll_transcript_279814

• Blastp: Protein PAM71-homolog, chloroplastic from Arabidopsis with 47.55% of identity
• Blastx: Protein PAM71-homolog, chloroplastic from Arabidopsis with 47.55% of identity
• Eggnog: transmembrane protein 165(COG2119)
• Kegg: Link to kegg annotations (AT4G13590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413170.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;