Protein coding transcript 83221

• Transcript: Ll_transcript_279700
• CDS coordinates: 414-1499 (+)
• Peptide sequence: MAPYKYRGALNIGFQMSITIGILVANILNYFFAKIKGGWGWRLSLGGAMVPALIITIGSLVLPDTPNSMIERGDRDAAKLQLQRVRGVDNVEEEFNDLVAASEASMLVEHPWRNLLQRKYRPQLTMAIMIPFFQQFTGINVIMFYAPVLFNSIGFKDDASLMSAVITGIVNVLATSVSVYGVDKWGRRALFLEGGTQMLICQAVIAAAIGAKFGINGNPGELPKWYAAVVVVFICIYVAGFAWSWGPLGWLVPSEIFPMEIRSAAQSVTVSVNMLFTFLVAQIFLLMLCHMKFGLFIFFGFFVFVMTVFIYFMLPETKGIPIEEMGRVWKEHPYWSRFVEHEDYGNRGVELGNGTRTNKDV*
• ORF Type: complete

Annotations of Ll_transcript_279700

• Blastp: Sugar carrier protein C from Ricinus with 78.95% of identity
• Blastx: Sugar carrier protein C from Ricinus with 79.4% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (8275367)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422866.1)
• Pfam: Sugar (and other) transporter (PF00083.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;