Protein coding transcript 83228

• Transcript: Ll_transcript_279696
• CDS coordinates: 414-1490 (+)
• Peptide sequence: MAPYKYRGALNIGFQMSITIGILVANILNYFFAKIKGGWGWRLSLGGAMVPALIITIGSLVLPDTPNSMIERGDRDAAKAQLQKVRGVDDVDEEFNDLVAASEASMLVENPWRKLLQRKYRPHLTMAILIPFFQQFTGINVIMFYAPVLFSSIGFKDDASLMSAVITGVVNVVATTVSVYGVDKWGRRALFLEGGAQMLICQAVVAAAIGAKFGIDGNPGDLPKWYAVVVVLFICIYVAGFAWSWGPLGWLVPSEIFPLEIRSAAQSITVSVNMLFTFLVAQVFLLMLCHMKFGLFIFFGFFVFVMTLFIYFFLPETKGIPIEEMGRVWKEHPYWSRFVEHEDYGNGVEMGKGATKNV*
• ORF Type: complete

Annotations of Ll_transcript_279696

• Blastp: Sugar transport protein 1 from Arabidopsis with 79.78% of identity
• Blastx: Sugar transport protein 1 from Arabidopsis with 80% of identity
• Eggnog: Transporter(ENOG410XNQK)
• Kegg: Link to kegg annotations (AT1G11260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434600.1)
• Pfam: Sugar (and other) transporter (PF00083.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;