Protein coding transcript 83364

• Transcript: Ll_transcript_280704
• CDS coordinates: 3-332 (+)
• Peptide sequence: QSHRFQQLLNLNFNRFWAQNKMSMNSPRYSSPPRRGNGGRGGSPPSSPPPTRRGYGGGGGRGRRRENNTGSLMVRNIPPHCQRGQIRIQFEQFGPVLSVHVPKDYNTGG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_280704

• Blastp: Serine/arginine-rich SC35-like splicing factor SCL33 from Arabidopsis with 43.75% of identity
• Blastx: Serine/arginine-rich SC35-like splicing factor SCL30 from Arabidopsis with 75% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (AT1G55310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460822.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;