Protein coding transcript 83365

• Transcript: Ll_transcript_280705
• CDS coordinates: 913-1479 (+)
• Peptide sequence: MNRQIFAGREISVVVAAETRKRPEEMRHRTSRFRGSGSYGGRRSSHYGRSRSRSISRSRSRSPPYHSGSRNRYHSRSYSPAPRRHSDYSVSPRRPVEHPRSPRSPPRERDGDQNRRSYSPGERDGDQNRRSYSPPYGDGADQNPNNGYAEKVIYKSEADREQWKSSRASRSPPGSRSRTPDLSPRHGR*
• ORF Type: complete

Annotations of Ll_transcript_280705

• Blastp: Serine/arginine-rich SC35-like splicing factor SCL30 from Arabidopsis with 76.67% of identity
• Blastx: Serine/arginine-rich SC35-like splicing factor SCL30 from Arabidopsis with 77.78% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (AT3G55460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456725.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;