Transcript | Ll_transcript_280681 |
---|---|
CDS coordinates | 141-806 (+) |
Peptide sequence | MRRNSPGYYSPPRRGYGGRGRSPPPPPPPSRRGHGGGGGGRRRESNNGSLLVRNIPLDCRSEELRVPFERFGPVRDVYIPKDYYSGQPRGFAFVQFVDSYDASEAQYHMNRQIFAGREISVVVAAETRKRPEEMRHRTSRFRGSGSYGGRRSSHYGRSRSRSISRSRSRSPPYHSGSRNRYHSRSYSPAPRRHSDYSVSPRRPVEHPRSPRSPPRERDGDQN |
ORF Type | 3prime_partial |
Blastp | Serine/arginine-rich SC35-like splicing factor SCL30 from Arabidopsis with 83.15% of identity |
---|---|
Blastx | Serine/arginine-rich SC35-like splicing factor SCL30 from Arabidopsis with 83.15% of identity |
Eggnog | Rna-binding protein(COG0724) |
Kegg | Link to kegg annotations (AT3G55460) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456725.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer