Protein coding transcript 83374

• Transcript: Ll_transcript_280670
• CDS coordinates: 129-722 (+)
• Peptide sequence: MSQFLKPENALKRAEELINVGQKQDALQTLHDLITSKRYRAWQKTLERIMFKYVELCVEMRKGRYAKDGLIQYRIICQQVNVGSLEEVIKHYIHLSTEKAEKARSQAQELEDALDVDDLEADKKPEDLMLSYVSGEKGKERSDRELVTPWFKFLWETYRTVLEILRNNSKLEALYAVCFLPPSFAICWSCYSFVICI*
• ORF Type: complete

Annotations of Ll_transcript_280670

• Blastp: Eukaryotic translation initiation factor 3 subunit A from Nicotiana with 84.83% of identity
• Blastx: Eukaryotic translation initiation factor 3 subunit A from Nicotiana with 84.83% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107760201)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425525.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;