Protein coding transcript 83381

• Transcript: Ll_transcript_280674
• CDS coordinates: 710-1843 (+)
• Peptide sequence: MDLKSNHTPVLTDSAAPINITKSRLGVHSSLLPYSPTGTTIPHSMLLTIPRKKAGFLEDVRSSGWLDSMKSSSPPPRKITKDVSLGFASSEADSSYFSWLLKYPSALTSFEQITNYAKGKRIALFLDYDGTLSPIVDNPDCAFMSDNMRAAVKKVAEYFPTAIISGRNRDMVYEFVGLTELYYAGSHGMDIMCPVKSTNNQKQDMEVNLFQPAAEFLPMIDEVFRSLVETTKDIKGAKVENNKFCAAVHYRNVDAKNWDLVGQCVHDVLKGYPRLCLTHGRKVLEVRPVINWDKGKAVTFILESLGLANCDDVLPIYIGDDRTDEDAFKVLREGNKGYGILVSSAPKQSNANYSLRDPSEVMEFLKSLVVWKSSQAL*
• ORF Type: complete

Annotations of Ll_transcript_280674

• Blastp: Trehalose-phosphate phosphatase A from Arabidopsis with 66.5% of identity
• Blastx: Trehalose-phosphate phosphatase A from Arabidopsis with 66.5% of identity
• Eggnog: trehalose biosynthetic process(COG1877)
• Kegg: Link to kegg annotations (AT5G51460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413839.1)
• Pfam: Trehalose-phosphatase (PF02358.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;