Transcript | Ll_transcript_278567 |
---|---|
CDS coordinates | 47-442 (+) |
Peptide sequence | MASSEIVVGLSSSDSKPNQNHDQDQPSILDVFTASAHGHFPKLRSFVEQDAASVSVPDVNGYYPLQWASLNNFHEIVNYIIQHGGDVNATDYMQQTALHWAAVHGSTAAADVLLENGARVEAADINGYRVF* |
ORF Type | complete |
Blastp | Probable protein S-acyltransferase 23 from Arabidopsis with 56.49% of identity |
---|---|
Blastx | Probable protein S-acyltransferase 23 from Arabidopsis with 58.62% of identity |
Eggnog | Ankyrin Repeat(COG0666) |
Kegg | Link to kegg annotations (AT2G14255) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421924.1) |
Pfam | Ankyrin repeats (3 copies) (PF12796.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer