Protein coding transcript 83460

• Transcript: Ll_transcript_278573
• CDS coordinates: 47-676 (+)
• Peptide sequence: MASSEIVVGLSSSDSKPNQNHDQDQPSILDVFTASAHGHFPKLRSFVEQDAASVSVPDVNGYYPLQWASLNNFHEIVNYIIQHGGDVNATDYMQQTALHWAAVHGSTAAADVLLENGARVEAADINGYRAVHVAAQYGQTAFLNHIVVKYHADFDVPDNDGRSPLHWAAYKGYADTVRLLLFRDASQERQDKDGMLSWPLIPLSVCTNP*
• ORF Type: complete

Annotations of Ll_transcript_278573

• Blastp: Probable protein S-acyltransferase 23 from Arabidopsis with 59.43% of identity
• Blastx: Probable protein S-acyltransferase 23 from Arabidopsis with 59.43% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (AT2G14255)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421924.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;